PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02701.1.g00110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 267aa    MW: 29765.1 Da    PI: 9.739
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02701.1.g00110.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.21.6e-12452148
                                  TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+W++eEd l+ + ++++G g +W + ++t+g+ R++ +c+srw++yl
  Zmw_sc02701.1.g00110.1.am.mk  4 KGKWSKEEDRLIRNHIEKHGIGhSWQSRSNTLGLQRCGRSCRSRWLNYL 52
                                  79*********************************************97 PP

2Myb_DNA-binding36.71e-1159102247
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   g++T+ Ed+ + +   ++G+  W+ Ia+ ++ gRt+  +k++w++ 
  Zmw_sc02701.1.g00110.1.am.mk  59 GNFTPAEDKVICEMYSKMGSC-WSVIAAQLP-GRTDLAIKNYWNST 102
                                   89*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.745156IPR017930Myb domain
SuperFamilySSF466894.31E-25299IPR009057Homeodomain-like
SMARTSM007178.5E-7354IPR001005SANT/Myb domain
PfamPF002493.0E-10452IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-18559IPR009057Homeodomain-like
CDDcd001672.47E-7652No hitNo description
SMARTSM007171.4E-1157105IPR001005SANT/Myb domain
PROSITE profilePS5129415.05957107IPR017930Myb domain
PfamPF002492.1E-1059102IPR001005SANT/Myb domain
CDDcd001673.36E-860103No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2260109IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MRKKGKWSKE EDRLIRNHIE KHGIGHSWQS RSNTLGLQRC GRSCRSRWLN YLRPGLKHGN  60
FTPAEDKVIC EMYSKMGSCW SVIAAQLPGR TDLAIKNYWN STLKKRFRWV RTAARRRPRP  120
SPTASTSSDA RTPAQDLQLI VYSEESSTAG SSCAKPVLPS SPTSAKAVKL LAPVAAGREP  180
IEAVPVRANA PVRTEQKPSV ESLPLMTPTA PPPPADRRDH TDQSDEMAMD IISMPMSPIP  240
LGFMDLELAC ICGFDDIDNF LPWFDGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-22410727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661280.11e-106PREDICTED: transcription factor RAX2-like
TrEMBLK4AED71e-92K4AED7_SETIT; Uncharacterized protein
STRINGSi037244m3e-92(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122282638